Skip to main content

Excellence vs Perfection

There is huge confusion between excellence and perfection. Both are rewarding but...
Perfection has limitations, you can not make anything perfect above 100 marks. This is where either you beat the competition or get beaten. Normally both happens. Excellence is about achieving 100%. You can achieve 100 marks in a given task at that point you may argue that here I achieved full percentage. But analogy says, you have achieved it about the task and not around the task. When you strive to achieve around the task there is no upper limit. For example an student may get 100 out of 100 marks in a given examination does that mean he / she 100 perfect in all those topics around what questions were asked or as that employ that there is no one out there in the world who knows better than the student who have faced an examination. This is why governments take Essay test before selecting you for a given post.
In companies awards are given to best employees do you know why? So other employees try better than what previous employee already have done. And other do that in the next year. Why because there is still space left to make things much better. Awards for best performers, top achievers, best products, best services are given to encourage coming generations to do better. Better is the word that always stays ahead of best.
Excellence is to hunt for more. You strive for excellence when you have hunger for more, when you are not satisfied, when you are not settled. Perfection often comes within boundaries of known knowledge but excellence is when you strive for the unknown.
This is how discoveries happens. Discoverers are never settled. They always want more beyond the unknown.
Whether you are business person, students or anyone if you are settled what you have accept the bitter pill there is someone out there in the world who have achieved all what you have but still not settle. There is someone who is striving for the more. Strive for excellence, make smaller what you already have and achieve more. Possibilities are limitless and open to all. 

Comments

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…