Skip to main content

Posts

Showing posts from December 20, 2019

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…

How paid advertising is important for professionals

Are you looking for leads through content marketing, are you individual who don't have a team? Do you not have budget to hire quality writers? If yes then this article is useful for you. Content marketing is all about educating your consumers, You need to write lots of useful content and share with your potential clients. You need to reach to everyone.
Organic traffic has high value, search engine values it, readers values it. When your blog appears in the top 10 for a search query readers notice it. But in today's world all readers do not go for search instead they ask friends, asking is a habit. Perhaps you have seen people on traffic lights with Google Maps running on mobile and still they ask someone hey, where this address falls. Human answer give driver an assurance that he/she is driving in right direction. Your blog need to be seen by many. If you are a professional, a service provider, a consultant or someone who sales a product and look for consumers online. All you…