Skip to main content

Create and sell program with help of Guidable App

Are you an expert in something?  Have you written a book or a blog?  Perhaps you have many blog posts. Do you want to sell your skills and teach your audience?
If you are an expert of something chances are you are looking to reach to more people and earn some money too.
When you build a website for selling it comes with many challenges, if you want to accept online fees,  payment gateway will charge you.
Building a website is costly for selling a program if you are short on budget.
To help you here is an app for experts  called Guidable
This app is free,  you download and Install for Android and iOS.
Process is simple,  download and install apps and start creating courses.  If you already have blog posts,  paste the content in your Guidable.  Billing issues will be handled by the app itself.  You can create courses worry free.
This product is listed on ProductHunt.  Read user reviews here
https://www.producthunt.com/posts/Guidable

Comments

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…