Skip to main content

6 Reasons Your Website Need A Remake In ‘New Year’

Everything needs a remake so does your website. Time is changing, perhaps the time you started your first ‘Hello World’ page was the era when Mars was a mystery, but now we know, the red planet has signs of water. Today we can draw planet mars on paper much explicitly. How old you were when writing your first web page stared? Perhaps, you want to say, that’s none of my business or you were older than I can think. Well, do you eat same food, wear same cloth or sleep on same bed where you were sleeping couple years back? I am sure, now your answer is a firm NO. Then why your website is still lying in those fixed frames? No matter how big your brand is, taking little care of your website every now and then will surely boost your business. What’s the time better than the festive season to look for a website design overhaul? Your website needs a change for following reasons:

revision
Remake Your Website Now!!!
#1. It’s not visible to search engines

SEO is old school, but not an outdated curriculum and it will never be. If your website is not visible to search engines or found deep down to some 50th or 100th or nth page in search results, you need to look seriously. People check through search engines when they need a service or product the most. If your website is not found-able on top of search results, you will loss business. Go for a website overhaul in the New Year to multiply profits.

#2. It’s Not Responsive

It’s the era of pocket PC. Almost half of the businesses world over happens over small screens. People do more on the go than when they are truly at work desk. Digital Nomad is new community! If your website is not optimized for small screen size devices; tablets, phablets and smartphones, you will loss on huge market share. A basic website made in HTML and CSS simply look ugly on small screen sizes. It’s the time to Bootstrap your websites and blogs. Go for a design overhaul.

#3. Analytics Says Your Bounce Rate Is High

Every visitor is a potential customer. High bounce rate means either your audiences are not getting exact stuff or it’s plainly painful to browse. Unlike 10 years back from now, when you were competing with some 100 websites in your niche, now you are competing with many thousands. Painful browsing means your site visitor won’t shy in closing the browser tab. If this is the case, seriously look for possibilities, and redesign is the one thing.


#4. Content Not Revised Since Ages

Content is meat for your website, add little opium to it. Since how long you didn’t revise the website copy? Is it same old content that you published years ago? Then you need revision of it. Rules of Grammar are same but literature gets better with passing time. The facts and figures those your website pages hold may be now old and outdated. You need to redo it. Revise your website copy, articles and blog posts; make it awesome. The content written on your website will be suitable for present generation to generate more leads and do more business.


#5. It Does Not Look Beautiful

Design leaves the first impression on your audience. If your website is not awesome, they will be happy in finding a similar one with more cool look and playful features. Nobody likes boring experience so not your audience.


#6. Your Target Market Has Changed

Over the years, perhaps you added / subtracted many products and services to / and from your website. Obviously your geography has changed up to a significant level. Make the design that is suited to your target audience.

Comments

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…