Skip to main content

How to backup all your Facebook data

Backing up is important. Financial Backup, Health Backup (Insurance) and Digital Data Backup. Fear and Curiosity are two major factors behind all major inventions. I last a Facebook account with very limited number of friends in the times when there was happening business talks between me and CEO of a Nepalese Company. No, I am not a spammer, but perhaps facebook felt something wrong with me, I don't know. Now I am extra careful while using any social media. I know many people create fake facebook accounts, but I don't like those practices.

Very recently I got to know through a news feed that Social Media Examiner last there Facebook page with massive fan followings, though facebook restored it later, but question arises, what will happen to the trust of those followers who love reading through your news feeds. In case you lost a page or completely banned from using your facebook, how to tell people (friends, fans, followers) your whereabouts. I am still unable to find track of my valuable customers from previous account. So I do not suffer losses again, I started looking for backup methods. Here are my findings.

How to backup your Facebook book profile data

Your can back up your Facebook profile data in matter of 5 to 10 minutes. Steps are given below

  • Log In to your Facebook Account
  • On the extreme top corner look for arrow icon pointing downwards.
  • Click on the arrow
  • Drop down menu will pop up
  • Click on settings
  • You will be navigated to General Account Settings
  • Find Download a copy of your Facebook data and click on it.
  • You will take to Download Archive page; click on it
  • A pop up will appear asking for password, provide your Facebook Password and click submit
  • A message will appear, Facebook is preparing your archive to send to your email.

The Facebook Data will be delivered to same email address that your provide in your FB profile (Primary Email Address)

Now go to your email, in the Inbox you find two emails from Facebook, 1. Archive is requested and 2. Download Archive. Open the second one

  • Inside email you find link to download facebook archive, click on
  • Provide Facebook Password, Click Submit
  • Archive will pop out, which is a zip file.
  • Save it in your computer disk

Now you have all your facebook profile data in your PC including your contact details, photos, news feeds, stats and friends name etc.

Did you find this article useful. Do me a favor by clicking a social media button below and post your valuable comments.   
Labels:

Comments

Post a Comment

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.
4 comments
Read more

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.
Post a Comment
Read more

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…
Post a Comment
Read more