Skip to main content

Psychology of bargain

In this part of continent 'India' bargain happens around everything. No matter how much you are honest in pricing the customer or how low you quote your price majority of consumers always think if they can get more for much less. Even if you offer a free stuff chances are you will be taken for granted. And you cannot control it. If you are a seller you cannot control the buyers behavior. But yes you can control the sellers behavior. No, not by changing the sellers attitude but by changing yourself.

There is an old saying, 'beggars are not choosers', if you bargain too much, always ask for discount and always want to overuse others you are the person creating that non-sense majority. If you are serious buyer and you need that thing, you should have three questions when buying something: 1. Is this product useful for me, 2. How much it cost and 3. How much discount is offered. If all three things suits you buy it else leave and look for alternative option a different product a different service that suits your needs and pocket both.
I have seen people bargaining hours for few bucks, those are the people who don't value their time. By spending those few bucks which you feel may be saved you will save a lot of time plus you will build a person that is you who have value for time than money. This does not mean you pay blindly if you do that world will make you a beggar. You should be a conscious buyer who should the value of product for money.
In the first place no bargain will create you and also this will build a community around you. The sellers who serve you will refrain from cheating on you because they know you are the serious customer. Also your children, your domestic help, your coworkers will learn from you, the value of time and energy.
The people who bargain a lot in back of mind think that they have saved a lot of money but in practice they never they have picked a third grade product or service and also lost lot of time which is valuable.
Sir Richard Branson often say, time is the new money. Anything that build till today for human development has one thing in common, it saves lot of time. Technology is an investment towards saving time, its one factor that make people to learn and use technology.
The people who spend time in bargain have poor thinking inside their mind. I never found a miser rich. If you find one do put in cage and announce to the world 'come and see the biggest miser of the world for one coin. You will be richer in a moon day.
If you are a businessperson or intended to be one learn to save your time.

Comments

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…