Skip to main content

9 must contract clauses for freelancers

Freelancers are supposed like a machine that never get tired, do not have own life. Majority of business managers deals freelancers like that. They all are not wrong. For them what important is your work, they do not have human connection with you. Its directly give and take relationship. However, as a freelancer when you are about to sign a contract must include these points in your contract clause. If you client is serving a contract clause request to include these points in the clause.

1. Work description
Make a detailed work description point wise. What you will do. Best way to draft is listen your client and make sharp pointed notes. So your client and take agreement. Include this in the contract clause. This way you will delivery exactly what was asked not more not less. Also this will save you from trouble when a client suddenly want to change everything or seek to do more.


2. Pricing / Rates
Make your pricing clear, whether you charge hourly/monthly/weekly/project basis or any other way round, make it clear to client and include in the clause. Also includes discounts if you are offering any.

3. Payment Denomination
In general there is a 40-40-20 rule. That means 40% upfront during contract, 40% after first draft and 20% after final delivery. Also you can go for a 50-25-25 or some other way round as you and your client feel ok with. Also include the mode of payment. Never receive in-cash payment or payment before contract signed. Some clients make hurry in first payment, they pay small even before you sign the project and then take advantage of it. Make rules and stick to them.

4. Revisions.
One free revision, however, some freelancers also go for 2 or 3 revisions. However put this point in writing so you do not end up doing overwork.

5. Single Point of Contact
There should be only person who can contact you related this project and give instructions. Name the person in contract clause.

6. Hours of calls and limitations
Some clients are mean. Also they consume whole lot of time in useless talks. Mention in your contract how many time a client can call you and for how many minutes. And during what time of the day. Prefer email communication and telephonic only when its a compulsory. In email everything is writing. You will avoid unnecessary trouble and unwanted talks.

7. Withhold / Discontinuation Fee
Sometime in mid of project client ask you to stop work or entirely stop the project. If this happens make rule. How much you want if client discontinues mid way.

8. Copyright
Your work is your property till you are not fully paid. Get it signed.

9. Deadlines
Make a clear time line of delivery. If you are delivering in part or in one go put corresponding dates on paper. Keep lag time in mind. Suppose you can deliver a work in a week, then commit 10-12 days. If its a months, commit in 40 days and like. Timelines are very important.


Comments

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…