Skip to main content

Consistency

That one word discussed less often. People talk about Goals, give examples, create noises and vanish. But interestingly nobody talks about play field. Goals when set are not achieved. This happen more than often because then our concentration goes to goal post and bypass everything in between. Let me tell you an incident.
I started a blog, thought let's see if I will get visitor, few visitor happen.
I started running Google adsense, thought let's see if I can get advertisement. It started happening.
I thought let's do more post and see how everything changes. Visitor started increasing.
I thought because I work alone, lets see what will happen if I do quality post. Blog start booming.
I started making Good money, sufficient to live in any Indian City. And here started my bad days.
For few days I was out of work. At this point out of nothing no solid reasons because I was away and blog earnings were less
I thought how to make more money, I shifted my focus from audience to money. Today I am earning zero.
I focused on goal instead of play field, result, blog is broke.
I am sure if I have taken it up from the point where it was left, it may have gained momentum again. But I did mistake. However, let me tell you, this was also my testing part, I was willing to know how it will work. There is huge noise in the world about making money I took risk and found goal is not important than play field. When you are in the field goals will happen.
Consistency is not about never stay out of the play field. At times it happens and we loss hope and become victims of our own frustrations.
If you discontinue a task for some reason but this is your task which is left undone start again from the point at which you have left before. Consistency is to focus on play field, not on goals. If you are in the field goals will happen.
Let me share with you one more story.
I was good learner, if you say super I will love it. Since childhood I was told my uncle was a Gold medalist twice in academics. It become a goal for me to wil Gold medal, I never got one because my focus was medal not the field. Today I know this. And I am pretty sure.  Play field was study but my orientation changes slowly slowly as I grown up, like any other teen I was also too excited and that excitement killed everything.
Heck, nobody told how uncle did at home and playground.
That is a top secret I am not going to tell you anyway.
Because I lost, I lost gold medal, I won't like if another child also loose it.
In business and business of life often we become victim of information overload.
Let not that happen to you.
Forget this article.

Comments

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…