Skip to main content

Get Free 2 GB Of Google Drive Today

Google is giving away 2 GB of Free Google Drive space today. This exercise was also carried out a year before by Google. Whether you reap the past benefits or not you can claim your free storage. More online storage is good thing and specially when its free why to be deprived of it. As you know more free online storage means more freedom to store your data. You can do this in simple steps, which does not take more than 2/3 minutes in total. I claimed my free storage and happy with it.

  • Log on to Google Account
  • Provide Email Id and Password
  • Review: two-step verification settings, account recovery information, and which apps have access to your Google account


And you are done.

Its pretty simple like taking a survey. Matter of chance this year's Google Free Give Away Google Drive Storage coincides with Safer Internet Day 2016.

Claim your storage
Labels:

Comments

Post a Comment

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.
4 comments
Read more

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.
Post a Comment
Read more

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…
Post a Comment
Read more