Skip to main content

Portfolio

I am proud to work with many clients in different niches under various capacities. Thanks to all those who imposed trust in me; that's the reason I am truly capable in multitasking. You can view my services page for details. 

I started working as web producer in the year 2002. After working 7 years in full time role, i switched to work on contract. This allows me to think freely and write during hours of the day when my mind is most productive. 

I write my blog www.careercare.info around education and job; write technical articles here at DKOffice.in around Writing, Technology, Social Media, SEO and Blogging.

To make my living I play with computers, research around huge databases on Internet and work on demand for many customers across the globe. I am a good researcher.

Here is the small list of my clients with whom either I am working or worked in past.

1. Pragati Infosoft Pvt. Ltd., New Delhi (Job: Web Architecture, Content Writing, Copy Writing, Academic Writing, SEO, Forum Moderator, Media Manager): These are special customer to me. I worked for them full time before leaving office in 2007, while on hunt for new contracts I approached them again and CEO of the company whole heartily welcomed me with new assignments on contract basis.

2. Khurmis Publishing Group, New Delhi (Job: Academic Writing, Technical Writing, Editing, Research; Question Bank Preparation): Very Special Customer, Worked with Groups Managing Director Dr. RS Khurmi a well known authority in India for Applied Mechanics and Strength of Materials. Proud doing loads of manuscripts for them.

3. Crescent Events, New Delhi (Copy Writing): Sunny is a wonderful customer, very decent guy, despite awesome background he is very down to earth. I am sure nobody can forget him.

4. OJ SEO, New Delhi (Job: SEO Writing): Good guy, faster payment.

5. 3Q Services Services, Delhi (Job: Article Writing): Nice Gentleman I worked with.

6. Bannus Technologies, Hyderabad (Job: Reference Style Writing): Very knowledgeable customer

7.  Narola InfoTech, Gujarat (Copy Writing): Special Customer who keep to his words.


8. A to Z eBook Conversion, Pondicherry (Job: Copy Writing, Content Writing, SEO): I had cool experience working with these guys.

9. B3 Multimedia, Ireland (Job: SEO Article Writing, Copy Writing ): Wonderful guy to work with.

10. Almora Consultants, Ireland (Job: SEO Article Writing, Copy Writing): Very supporting personality.

11. Zeddes Social Media, Qatar (Job: Copy Writing, Content Writing, SEO, Social Media Management): Very special customer to me; Venkat, the group owner is just another friend anybody will like to work again.

12. TheDealCutters.Com, USA (Job: Copy Writing): Very loyal customer, Ericka understands the real value of copy writer.

13. Bloomer Digital, UK (Job: SEO Writing). Wonderful human being, anybody will like work again for them.

14. KeyStrokesManagement, Kolkata, India (Copy Writing, Content Writing, SEO): I met Abhijit through PPH; very good person, appreciates good work and faster in payment. He work with me outside PPH too.

15. Techchase.in, Mumbai: (Job: Technical Writing): It was a nice experience to work for Techchase.in. They always appreciate good work.

16. YourRavi.Com (Job: Technical Writing): Though I worked only few articles for this blog, but to be true 'Ravi' is such a great guy, you will always learn a thing or two from him.

17. TechOneMedia (Job: Technical Writing; SEO): Nice customer to work with.

18. Spider Network, Kerala: Techulator.com, Indiastudychannel, StudyVillage, IndiaTravelBlog, HondaMobilio.in, ScooterGuru.in, MicrowaveRevews.in (Technical Writing, Academic Writing, SEO Writing, Editing, Reviewing): Working with people of Spider Group is truly great experience. 

19. IndiaOnline : Content Strategist and Technical Writer for Shiksha Project; World Education Network

20. Relativity Management Solution: Content Consultant and Writer

I am Channel Partner with IndiaOnline.in For all type of advertising enquiries drop me an email (devkmishra@gmail.com) and we will set a time for disucssion.

Thanks to CEOs and Business Managers with whom i worked in the past and working presently!

Do you have a job? Hire Me!

Popular posts from this blog

5 SEO tips to take your business to new level in New Year 2015

Greetings, Parties and Hangover are all over. Now its times to look back what you have achieved in past year(s), find your weak zones, make plans for improvements and take your business to new heights.

Irrespective of the kind of business and strategy you follow; SEO makes parts of every business. Better SEO means better business. To give your SEO strategy a boost here I am sharing 5 simple tips, you will found worth!

1. Look back 
Yes, you heard right. ‘Look back inside technical aspects of your website.’ Make a check thoroughly for anything broken inside, may be a social media button, a web page with error 404, robot issues or Google Analytics Conversion Errors. Make good use of Google Webmaster Tool to find any and all errors. Remember search engine downgrades even best of the websites for any errors in code whether error is caused by you or third party application.

Google Doodle- Srinivasa Ramanujan 125th Birth Anniversary

Google is celebrating Srivinavas Ramanujan's 125th birth anniversary today, December 22. On this day, 125 year ago this self made mathematician was born in Erode town of Tamil Nadu in India. Thanks to GH Hardy, who found genius in Ramanujan. And thanks to Google for reminding us an star was born on this day. Doodle shows mathematical theorems in the letters of the word GOOGLE being written by a small child, when i hit over Doodle it results into About 437,000 results (0.33 seconds) at the time of writing this article.

List of 1500 plus top level domain

When a dot com cost as high as size of virgin island, a dot org is taken, a dot net is premium but you need a top level domain for your business, here is list of 1500 plus top level domain. You can chose your own and start building your website. This list is sourced from ICANN.ORG
AAAAARPABARTHABBABBOTTABBVIEABCABLEABOGADOABUDHABIACACADEMYACCENTUREACCOUNTANTACCOUNTANTSACOACTORADADACADSADULTAEAEGAEROAETNAAFAFAMILYCOMPANYAFLAFRICAAGAGAKHANAGENCYAIAIGAIGOAIRBUSAIRFORCEAIRTELAKDNALALFAROMEOALIBABAALIPAYALLFINANZALLSTATEALLYALSACEALSTOMAMAMERICANEXPRESSAMERICANFAMILYAMEXAMFAMAMICAAMSTERDAMANALYTICSANDROIDANQUANANZAOAOLAPARTMENTSAPPAPPLEAQAQUARELLEARARABARAMCOARCHIARMYARPAARTARTEASASDAASIAASSOCIATESATATHLETAATTORNEYAUAUCTIONAUDIAUDIBLEAUDIOAUSPOSTAUTHORAUTOAUTOSAVIANCAAWAWSAXAXAAZAZUREBABABYBAIDUBANAMEXBANANAREPUBLICBANDBANKBARBARCELONABARCLAYCARDBARCLAYSBAREFOOTBARGAINSBASEBALLBASKETBALLBAUHAUSBAYERNBBBBCBBTBBVABCGBCNBDBEBEATSBEAUTYBEERBENTLEYBERLINBESTBESTBUYBETBFBGBHBHARTIBIBIBLEBIDBIKEBI…